PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe7G052800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family TALE
Protein Properties Length: 305aa    MW: 34302.6 Da    PI: 6.7217
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe7G052800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.21.1e-072532862154
                        HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
           Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                        k +yp+++++++L +++gL+ +q+ +WF N+R +
  Aqcoe7G052800.1.p 253 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 286
                        469*****************************87 PP

2ELK26.31.7e-09207228122
                ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                        ELK +L++++++++ ++++E++
  Aqcoe7G052800.1.p 207 ELKIELKQGFRSRIEDVREEIL 228
                        9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.1E-193882IPR005540KNOX1
PfamPF037903.7E-174081IPR005540KNOX1
SMARTSM012563.9E-2396151IPR005541KNOX2
PfamPF037912.6E-1699150IPR005541KNOX2
PROSITE profilePS512139.184207227IPR005539ELK domain
PROSITE profilePS5007111.612227290IPR001356Homeobox domain
SMARTSM003891.3E-10229294IPR001356Homeobox domain
SuperFamilySSF466896.84E-16229293IPR009057Homeodomain-like
CDDcd000866.46E-11230291No hitNo description
Gene3DG3DSA:1.10.10.604.8E-25234292IPR009057Homeodomain-like
PfamPF059201.0E-17247286IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MQEPSLGMLG SGSGGGGGGF SGLNENVSMS ISTADDHRQL KAEIATHPLY EQLLAAHVGC  60
LRVATPIDQL PLIEAQLSQS HQLLRFYASQ HHHQHHVLSP HEKQDLDHFL GQYLLVLCSF  120
KEQLQQHVRV HAVEAVMGCR EIEQSFQALT GVSLSEGTGA TMSDDEDDLQ LDCSMDQSGA  180
DGHDMLGFGP LLPTESERSL MERVRQELKI ELKQGFRSRI EDVREEILRK RRAGKLPGDT  240
TSVLKTWWQQ HSKWPYPTED DKAKLVEETG LQLKQINNWF INQRKRNWHS NSQSVTALKS  300
KRKR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A6e-13230286864Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1283303RKRNWHSNSQSVTALKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP3315350.0KP331535.1 Aquilegia coerulea KXL3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007040089.10.0KNOTTED-like homeobox of 7
SwissprotQ9FPQ81e-164KNAT7_ARATH; Homeobox protein knotted-1-like 7
TrEMBLA0A061G4010.0A0A061G401_THECC; KNOTTED-like homeobox of 7
STRINGGLYMA01G42410.11e-178(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-161KNOTTED-like homeobox of Arabidopsis thaliana 7